PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G059000.1
Common NamePHAVU_008G059000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 306aa    MW: 34517.9 Da    PI: 9.6657
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G059000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.4e-133781147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT  E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Phvul.008G059000.1 37 RENWTDTEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 81
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-163187IPR009057Homeodomain-like
PROSITE profilePS5129414.7213286IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-63587IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-173584IPR006447Myb domain, plants
SMARTSM007172.8E-103684IPR001005SANT/Myb domain
PfamPF002491.1E-103781IPR001005SANT/Myb domain
CDDcd001678.00E-83982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MVSLNSNPPQ TFPFLDPFNM EDPNKKVRKP YTITKSRENW TDTEHDKFLE ALHLFDRDWK  60
KIEAFVGSKT VIQIRSHAQK YFMKVQKNGT SEHVPPPRPK RKAAHPYPQK ASKNALTISK  120
VTRPLQSSSA LSESSYIYRP DSSSVLRTAV GSVPLSSWGY NLTPQVVLPE VTKDHMVSSQ  180
KVNPFNYCYS SSNESTPMGL PSSKQTDQGD QGQTIKAMPD FPEVYSFIGS VFDPNVTNHL  240
QTLQQMDPIN VETVLLLMRN LSTNLRSPEF ENERRMLSLY NANSERTKSS QPSLTDRSES  300
VILSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150378e-59AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139791.10.0hypothetical protein PHAVU_008G059000g
SwissprotQ8H0W31e-97RVE6_ARATH; Protein REVEILLE 6
TrEMBLV7B2K00.0V7B2K0_PHAVU; Uncharacterized protein
STRINGGLYMA18G47230.11e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.12e-82MYB_related family protein